Sequence 1: | NP_001287532.1 | Gene: | CG17198 / 43110 | FlyBaseID: | FBgn0039366 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848482.1 | Gene: | Zdhhc2 / 70546 | MGIID: | 1923452 | Length: | 366 | Species: | Mus musculus |
Alignment Length: | 354 | Identity: | 67/354 - (18%) |
---|---|---|---|
Similarity: | 117/354 - (33%) | Gaps: | 132/354 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 IPRRVGAIKSWTDIMGVSINVCIILFFYFFEAFYVMPQFLG-----LFGQAVHFLVTTWIVYNIL 84
Fly 85 ENLRLCVTTLNTVDSLPPQ-----------MQQPMKGEEH--------------------LWHFC 118
Fly 119 KICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFMLA 183
Fly 184 HKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRI------VSVLGVNIFAVLFPAALFCTQV-- 240
Fly 241 ---------------VTVIKNSVMHDYSDRT-YDLGLGNNLTLILG-SRRLW------------- 275
Fly 276 --TC--------------LSPNIKSPLPH 288 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17198 | NP_001287532.1 | zf-DHHC | 43..>176 | CDD:303066 | 38/168 (23%) |
zf-DHHC | 111..252 | CDD:279823 | 41/183 (22%) | ||
Zdhhc2 | NP_848482.1 | DHHC | 126..247 | CDD:366691 | 37/152 (24%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 296..366 | 4/25 (16%) | |||
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000269|PubMed:21471008 | 298..366 | 4/23 (17%) | |||
Non-canonical dileucine endocytic signal. /evidence=ECO:0000269|PubMed:28768144 | 334..335 | ||||
NPxY-like endocytic signal. /evidence=ECO:0000269|PubMed:28768144 | 357..360 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |