DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and zdhhc4

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_956343.2 Gene:zdhhc4 / 561817 ZFINID:ZDB-GENE-030131-9031 Length:345 Species:Danio rerio


Alignment Length:141 Identity:49/141 - (34%)
Similarity:66/141 - (46%) Gaps:20/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 QQPMKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWF--SFY 167
            ||.||        |..||...|.||.||.:|:.|:.:.||||.:|.||:|..|.|||:.:  |..
Zfish   148 QQGMK--------CSTCQLIKPARSKHCRVCNRCVQRFDHHCVWVNNCIGAQNTRYFMLYLLSVC 204

  Fly   168 AAIGSAVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVI------FYRIVSVLGVNI 226
            |..|:...|..:.:|......|   |:.|:||.......|.....:|      |.|||.:||..:
Zfish   205 AMAGNIAVLTTDMLLQTVLRTG---LLHAHYIDEQGIQQPAGPLFIIQHLFLTFPRIVFMLGFLV 266

  Fly   227 FAVLFPAALFC 237
            | |.|..|.:|
Zfish   267 F-VFFLLAGYC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 29/72 (40%)
zf-DHHC 111..252 CDD:279823 45/135 (33%)
zdhhc4NP_956343.2 DHHC 152..296 CDD:396215 46/137 (34%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 342..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.