DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and zdhhc20a

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_005172729.1 Gene:zdhhc20a / 561776 ZFINID:ZDB-GENE-070424-38 Length:369 Species:Danio rerio


Alignment Length:308 Identity:67/308 - (21%)
Similarity:111/308 - (36%) Gaps:96/308 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SWTDIMGVSINVCIILFFYFFE-AFYVMP----QFLGLFGQAVHFLVTTWIVYNILENLRLCVTT 93
            ||..::.:::.||...:.|..| ..|.:|    |.:.|......|.:..|..:            
Zfish    15 SWIPVIFINLVVCWSYYAYVVELCIYTIPNVNEQVIYLVVFHAFFFMFMWSYW------------ 67

  Fly    94 LNTVDSLPPQMQQPM---KGEEHLW-------------------------------HFCKICQRN 124
             .|:.|.|....:..   |.|:.|:                               .:|..||..
Zfish    68 -KTISSKPTNPSKEFCLPKAEKELYEKEERPEAQQDILKRVARELPIYTFTGSGAIRYCDRCQLI 131

  Fly   125 VPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYA---AIGSAVALFDNFMLAHKH 186
            .|.|..||:.||.|:||.||||.:|.||||.:|.::|:.|..|:   .:..|..:...|      
Zfish   132 KPDRCHHCSTCDKCVLKMDHHCPWVNNCVGFSNYKFFVLFLAYSMLYCVYIAATVLQYF------ 190

  Fly   187 GVGFFDLVKANYIIF---NAYMNPGRKELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVI---- 244
             :.|:.|.:...|..   |...:...|..|:|             :.|.||:|...::::.    
Zfish   191 -IKFWTLCRRRAIEHCPENQLPDTHAKFHVLF-------------LFFVAAMFFISILSLFSYHL 241

  Fly   245 ----KN---------SVMHDYSDRT-YDLGLGNNLTLILGSRRLWTCL 278
                ||         .|..:..|:. :.||...|:|.:.|.::.:.||
Zfish   242 WLVGKNRTTIEAFRAPVFRNGPDKNGFTLGFRKNITQVFGDQKKYWCL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 42/174 (24%)
zf-DHHC 111..252 CDD:279823 43/194 (22%)
zdhhc20aXP_005172729.1 zf-DHHC 12..309 CDD:303066 67/308 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.