DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and zdhhc9

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001103496.1 Gene:zdhhc9 / 560095 ZFINID:ZDB-GENE-071004-8 Length:382 Species:Danio rerio


Alignment Length:206 Identity:56/206 - (27%)
Similarity:91/206 - (44%) Gaps:63/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 FCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFM 181
            :|..|:...|||:.||:|||.|:.:.||||.:||||||..|.|||..|:.      :::|...::
Zfish   136 YCYTCKIFRPPRASHCSICDNCVDRFDHHCPWVGNCVGKRNYRYFYLFTL------SLSLLTIYI 194

  Fly   182 LAHKHGVGFFDLVKANYIIF----NAYMN-----PGR--KELVIFYRIVSVLGVNIFAVLFPAAL 235
            .|       ||:|   :::.    :.::|     ||.  :.||.|:.:.||:|:..|.       
Zfish   195 FA-------FDIV---HVVLRSVDSGFVNTLKETPGTVLEVLVCFFTLWSVVGLTGFH------- 242

  Fly   236 FCTQVVTVI-------------KNSVMHDYSDRTY-----DLGLGNNLTLILGSRRLW---TCLS 279
              |.::::.             ||.|.:.||.:..     ::..|.....:|..|.|.   :|  
Zfish   243 --TYLISLNQTTNEDIKGSWSGKNRVQNPYSHKNIIKNCCEVLCGPTYPSVLDRRGLMLEDSC-- 303

  Fly   280 PNIKSPLPHNG 290
                |..|.||
Zfish   304 ----SSAPSNG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 26/58 (45%)
zf-DHHC 111..252 CDD:279823 45/158 (28%)
zdhhc9NP_001103496.1 zf-DHHC 134..257 CDD:279823 42/145 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.