Sequence 1: | NP_001287532.1 | Gene: | CG17198 / 43110 | FlyBaseID: | FBgn0039366 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001358221.1 | Gene: | ZDHHC4 / 55146 | HGNCID: | 18471 | Length: | 359 | Species: | Homo sapiens |
Alignment Length: | 266 | Identity: | 65/266 - (24%) |
---|---|---|---|
Similarity: | 92/266 - (34%) | Gaps: | 82/266 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 GVSINVCII----------LFFYFF----EAFYVMPQFLGLFGQAVHFLVTTWIVYNILENLRLC 90
Fly 91 VTTLNTVDSLPPQM--------------QQP---MKGEE----HLWHF----------CKICQRN 124
Fly 125 VPPRSWHCN---------------ICDACILKRDHHCNFVGNCVGHNNQRYF-IWFSFYAAIGSA 173
Fly 174 VALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRIVSVLGVNIFAVLFPAALFCT 238
Fly 239 QVVTVI 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17198 | NP_001287532.1 | zf-DHHC | 43..>176 | CDD:303066 | 49/193 (25%) |
zf-DHHC | 111..252 | CDD:279823 | 42/164 (26%) | ||
ZDHHC4 | NP_001358221.1 | DHHC | 151..307 | CDD:366691 | 39/143 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3877 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |