Sequence 1: | NP_001287532.1 | Gene: | CG17198 / 43110 | FlyBaseID: | FBgn0039366 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021336686.1 | Gene: | zdhhc2 / 541365 | ZFINID: | ZDB-GENE-050320-58 | Length: | 374 | Species: | Danio rerio |
Alignment Length: | 353 | Identity: | 73/353 - (20%) |
---|---|---|---|
Similarity: | 122/353 - (34%) | Gaps: | 114/353 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 WTDIMGVSINVCIILFFYFFEAFYVMPQFLGLFGQAVHFLVTTWIVYNILENLRLCVTTLNTVDS 99
Fly 100 LPPQMQQPMKGEEHLWH--------------------------------------FCKICQRNVP 126
Fly 127 PRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFMLA--HKHGVG 189
Fly 190 FFDLVKANYIIFNAYMN-----PGRKELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVIKN--- 246
Fly 247 -------SVMHDYSDRTYDLGLGNNLTLILG-SRRLW---------------TCL---------- 278
Fly 279 ----SPNIKS-----PLPHNGTRWKSKR 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17198 | NP_001287532.1 | zf-DHHC | 43..>176 | CDD:303066 | 41/170 (24%) |
zf-DHHC | 111..252 | CDD:279823 | 44/195 (23%) | ||
zdhhc2 | XP_021336686.1 | zf-DHHC | 11..305 | CDD:327686 | 63/311 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |