DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_038942712.1 Gene:Zdhhc11 / 499000 RGDID:1564281 Length:364 Species:Rattus norvegicus


Alignment Length:328 Identity:66/328 - (20%)
Similarity:110/328 - (33%) Gaps:140/328 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GIMQSQV--QMQTINI----PRRVGAIK------------SWTDIMGVSINVCIILFFYFFEAFY 58
            ||.|::|  :.|..|:    ||.:..:.            |||..:.:||..             
  Rat     8 GIGQNRVLPEAQENNVKKLLPRPLSRVNGWSPPLHSFQAISWTTYLAMSIVT------------- 59

  Fly    59 VMPQFLGLFGQAVHFLVTTW-----------IVYNILENLRLCVTTLNTVDS---LPPQMQQPMK 109
                    ||..:.||.|:|           .:::::  :.|...|::..|:   |.....:|:.
  Rat    60 --------FGIFIPFLPTSWKYAANAVMGGVFMFHLV--VHLIAITIDPADTNVRLKKDYLEPVP 114

  Fly   110 GEEHLWH-------FCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFY 167
            ..:...|       :|.:|:..|..::.||:.|:.|:...||||.::.||||..|    .||.|:
  Rat   115 TFDRSKHAHVIQNQYCHLCEVTVSKKAKHCSSCNKCVSGFDHHCKWLNNCVGKRN----YWFFFF 175

  Fly   168 AAIGSAVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRIVSVLGVNIFAVLFP 232
            :...:|..|.         ||    |:...||....::||....:...|:..:|.          
  Rat   176 SVASAAFGLL---------GV----LIILLYIFIQYFVNPNGLRMDPLYKGAAVW---------- 217

  Fly   233 AALFCTQVVTVIKNSVMHDYSDRTYDLGLGNNLTLILGSRRLWTCLSPNIK-------------S 284
                                      :|.|            |||||..|:             |
  Rat   218 --------------------------IGAG------------WTCLSVFIEISSENTWLLFLSLS 244

  Fly   285 PLP 287
            |:|
  Rat   245 PVP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 33/153 (22%)
zf-DHHC 111..252 CDD:279823 31/147 (21%)
Zdhhc11XP_038942712.1 DHHC 123..294 CDD:396215 41/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.