DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and zdhhc24

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001002324.1 Gene:zdhhc24 / 436596 ZFINID:ZDB-GENE-040718-8 Length:295 Species:Danio rerio


Alignment Length:250 Identity:73/250 - (29%)
Similarity:108/250 - (43%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VHFLVTTWIVYNILENLRLCVTTLNTVDSLPPQMQQPMKGEEHL---WHFCKICQRNVPPRSWHC 132
            :|.....:::.||..|..|.|.|       .|.::....|.:.|   |.:|..|:.:.|||..||
Zfish    61 LHLFAQYFMLGNITWNASLFVKT-------NPSIRGVFLGGDTLGQGWRYCYNCETHTPPRCSHC 118

  Fly   133 NICDACILKRDHHCNFVGNCVGHNNQRYFI------WFS-FYAAIGSAVALFDNFMLAHKHGVGF 190
            ..|:.|:|:|||||.|.|.|||.:|.|||:      |.. .||.:.:|    :.|:...|.||.|
Zfish   119 YDCNVCVLRRDHHCVFFGQCVGFHNYRYFLTCLLFMWAGLLYAVVMNA----EVFIFILKEGVTF 179

  Fly   191 FD--LVKANYIIFNAYMNPGRKELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVIKNSVMHDY- 252
            ..  |:...:|:..:.....|.....|.....|:|     .|..||.....|..:::.....:: 
Zfish   180 HSVMLLLVPWIMLVSGQVTTRAFAFAFIADTCVVG-----FLLVAAFLFFHVALMLRGQTTREWY 239

  Fly   253 -SDRTYDLGLGNNLTLILGSRRLWTCLSPNIKSPLPHNGTRWK-------SKRAV 299
             :.|.|.||...|:...||....:..|.|.|.||||.:|..:|       .|:||
Zfish   240 STRRPYSLGTMANIRECLGKNWYFCWLCPLIPSPLPGDGINFKVTASLEPKKQAV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 39/114 (34%)
zf-DHHC 111..252 CDD:279823 45/152 (30%)
zdhhc24NP_001002324.1 zf-DHHC 100..239 CDD:279823 44/147 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47998
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.