DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and CG17197

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:251 Identity:103/251 - (41%)
Similarity:148/251 - (58%) Gaps:13/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LFFYFFEAFYVMPQFLGL--FGQAVHFLVTTWIVYNILENLRLCVTTLNTVDSLPPQMQQPMKGE 111
            :||...:.|||:||...:  |...:.:||..:|.|||..|:..|..|..:|:|||...|.|...|
  Fly    36 IFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSVESLPKDRQIPEPEE 100

  Fly   112 EHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVAL 176
            ||.||:|.:|::.:|||||||.:|..||||||.||.|..:||||||||||.||:.:.|:|:.|||
  Fly   101 EHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVAL 165

  Fly   177 FDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRIVSVLGVNIFAVLFPAALFCTQVV 241
            ..:.:...|: ..:.||:         ::|..|..|..|:.::::: :|.:....|.:....|:.
  Fly   166 ATHIIATLKY-FSYSDLI---------FLNIPRDNLPPFWLVITLI-LNTYVFAAPVSSVLMQLS 219

  Fly   242 TVIKNSVMHDYSDRTYDLGLGNNLTLILGSRRLWTCLSPNIKSPLPHNGTRWKSKR 297
            .:..|..:|.:...||||||..|..||||.:..||.|||.:||||||:|.:||.||
  Fly   220 VLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKIKR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 62/128 (48%)
zf-DHHC 111..252 CDD:279823 53/140 (38%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 11/33 (33%)
zf-DHHC 100..>198 CDD:279823 48/107 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469534
Domainoid 1 1.000 76 1.000 Domainoid score I5810
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
98.890

Return to query results.
Submit another query.