DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and CG4483

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:214 Identity:55/214 - (25%)
Similarity:84/214 - (39%) Gaps:62/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LVTTWIVYNI----------LEN-LRLCVTTLNTVDSLPPQMQQPMKGEEHL---WH-------- 116
            |:.||.|.::          ||: |...:..:.|..:|...::..|.|...:   ||        
  Fly    25 LIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMVGPGFVPLKWHPQLTKDKM 89

  Fly   117 ---FCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFD 178
               ||..|.....|||.||..|:.|::|.||||.::..|||.:||..|::|..:           
  Fly    90 FLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLF----------- 143

  Fly   179 NFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRI----------------VSVLGVNIF 227
             ||....||         ..||.:|.:...:|..:|.|.:                |..|||.:.
  Fly   144 -FMSGSIHG---------GIIIVSAVIRGIKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMG 198

  Fly   228 AVLFPAALFCTQVVTVIKN 246
            .||....|...|:.:::||
  Fly   199 TVLASIKLLYMQMKSILKN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 35/126 (28%)
zf-DHHC 111..252 CDD:279823 44/166 (27%)
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 42/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.