DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and CG10344

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster


Alignment Length:294 Identity:91/294 - (30%)
Similarity:131/294 - (44%) Gaps:56/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IPRRVGAIKSWTDIMGVSINVCIILFFYFFEAFYVMPQF--LGLFGQAVHFLVTTWIVYNILENL 87
            :|.|:      .||:...|....:...:.||...|:|.|  .|.|.....||:..::|:||..|:
  Fly     8 MPSRM------VDILCFLIIAVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNM 66

  Fly    88 RLCV---TTLNTVDSLPPQMQQPMKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFV 149
            ..|:   |::|.....||       .::..|..|..||:..|||||||..|..|||||||||.:.
  Fly    67 IACMMIDTSVNVKKVEPP-------SDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYT 124

  Fly   150 GNCVGHNNQRYFIWFSFYAAIGSAVAL--------------FDNFMLAHKHGVGFFDLVKANYII 200
            |.|:|..|.|:|:.|.||..:||..||              :.|::...|.......||..::..
  Fly   125 GCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSFWT 189

  Fly   201 FNAYMNPGRKELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVIKNSVMHDYSDRT------YDL 259
             |.|:        :||      .:||.|:.:...|....|..|::..|.   :|||      ||.
  Fly   190 -NMYL--------VFY------SLNILALAYGVLLLAYHVPIVLRGGVS---ADRTKESKEKYDR 236

  Fly   260 GLGNNLTLILGSRRLWTCLSPNIKSPLPHNGTRW 293
            |:..||..:.|:|.....|||.|:|.||.:|..|
  Fly   237 GVYQNLRSVFGNRMHLAWLSPLIRSDLPEDGYHW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 51/137 (37%)
zf-DHHC 111..252 CDD:279823 49/154 (32%)
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 47/141 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469553
Domainoid 1 1.000 74 1.000 Domainoid score I9123
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
98.890

Return to query results.
Submit another query.