DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and CG4676

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster


Alignment Length:286 Identity:92/286 - (32%)
Similarity:145/286 - (50%) Gaps:38/286 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IKSWTDIMGVSIN--VCIIL------FFYFFEAFYVMPQFLGLFG--QAVHFLVTTWIVYNILEN 86
            ::||..:...||:  .|.:|      ..|.|....|||:...:.|  ..:.:|.:.::::||..|
  Fly     4 LRSWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSN 68

  Fly    87 LRLCVTTLNTVD-SLPPQMQQPMKGEEHL--WHFCKICQRNVPPRSWHCNICDACILKRDHHCNF 148
            :..|:    .|| |:..::.:|......|  ||.|:.||..||||||||.:|:.|:|||||||.|
  Fly    69 MLACM----LVDTSIRKELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRF 129

  Fly   149 VGNCVGHNNQRYFIWFSFYAAIGS-AVALFDNFMLAHKHGVGFFDLVKANYIIFNAY-------M 205
            ...|:||:|.|||.::..|..||| |.|:.::..|.|.|    .|:......:|..:       :
  Fly   130 TCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLH----LDIYWRWSTLFTIFAPVVSLML 190

  Fly   206 NPGRKELVIFYRIVSVLGVNIFAVL--FPAALFCTQVVTVIKNSVMHDYSDRTYDLGLGNNLTLI 268
            :|..:...:....:::||..|.::|  |..::|.:       .||..:...|.||.||..||.::
  Fly   191 SPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKS-------GSVTRERGTRKYDRGLRGNLEMV 248

  Fly   269 LGSRRLWTCLSPNIKSPLPHNGTRWK 294
            ||.|...|.|||.::|.|||:|..|:
  Fly   249 LGKRMHLTWLSPFLRSDLPHDGMNWE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 54/146 (37%)
zf-DHHC 111..252 CDD:279823 51/152 (34%)
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 48/143 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469554
Domainoid 1 1.000 74 1.000 Domainoid score I9123
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
98.890

Return to query results.
Submit another query.