DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001034427.1 Gene:Zdhhc5 / 362156 RGDID:1589737 Length:715 Species:Rattus norvegicus


Alignment Length:203 Identity:55/203 - (27%)
Similarity:84/203 - (41%) Gaps:47/203 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 MKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGS 172
            :||.:....:|..|:...|||..||::||.|:.:.||||.:|.||:|..|.|||.          
  Rat    96 IKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFF---------- 150

  Fly   173 AVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELV---------IFYRIVSVLGVNIFA 228
               ||...:.||..||..|.|:   |::.:.....|.:..|         :|:  :.|.|:..|.
  Rat   151 ---LFLLSLTAHIMGVFGFGLL---YVLCHIEELSGVRTAVTMAVMCVAGLFF--IPVAGLTGFH 207

  Fly   229 VLFPAALFCT--QVVTVIKNSVMHDYSDRTYDLGLGNNLTLILGSRRLWTCLSPNIKSPLPHNGT 291
            |:..|....|  ||....:..|      ..:..|..||::.:|.|            ||.|....
  Rat   208 VVLVARGRTTNEQVTGKFRGGV------NPFTNGCCNNVSRVLCS------------SPAPRYLG 254

  Fly   292 RWKSKRAV 299
            |.|.::.:
  Rat   255 RPKKEKTI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 24/67 (36%)
zf-DHHC 111..252 CDD:279823 43/151 (28%)
Zdhhc5NP_001034427.1 zf-DHHC 99..224 CDD:279823 42/142 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.