DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and CG1407

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:307 Identity:71/307 - (23%)
Similarity:108/307 - (35%) Gaps:110/307 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VGAIKSWTDIMGVSINVCI-----------ILFFYFFEAFYVMPQFLGLFGQAVHFLVTTWIVYN 82
            :.|:.:|:....| :.:||           :|.||..        ||.||         .|..:.
  Fly    28 ITAVIAWSYYAYV-VELCIRNSENRIGMIFMLLFYHL--------FLTLF---------MWSYWR 74

  Fly    83 ILENLRLCVTTLNTVDSLPPQMQQPMKGEEHLW------------------------------HF 117
                     |.:.:|..:|.|.:.|.:....|:                              .|
  Fly    75 ---------TIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRF 130

  Fly   118 CKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFML 182
            |:.|:...|.|:.||::|..|:||.||||.:|.|||...|.:||:.|..||.:   ..|:..|..
  Fly   131 CEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALV---YCLYVAFTS 192

  Fly   183 AHKHGVGFFDLVKANYIIFNAYMNPGRKE---------LVIFY-------RIVSVLGVNIFAVL- 230
            .|    .|.:..|......|.|...|:..         |.:|:       .:||:.|.:|:.|| 
  Fly   193 LH----DFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLV 253

  Fly   231 -------FPAALFCTQVVTVIKNSVMHDYSDRTYDLGLGNNLTLILG 270
                   |.|.:|  :|....||.         |:||...|...:.|
  Fly   254 NRTTLESFRAPIF--RVGGPDKNG---------YNLGRYANFCEVFG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 41/173 (24%)
zf-DHHC 111..252 CDD:279823 48/194 (25%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 41/136 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467485
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.