DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and CG2611

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_610043.1 Gene:CG2611 / 35324 FlyBaseID:FBgn0032871 Length:132 Species:Drosophila melanogaster


Alignment Length:61 Identity:19/61 - (31%)
Similarity:28/61 - (45%) Gaps:7/61 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 IFAVLFPAALFCTQVVTVIKNSV---MHDYSDRTYDLGLGNNLTLILGSRRLWT--CLSPN 281
            |..:||...:.|....|:  |.|   ..:.|||.:.||:...||.|.||..::.  |:..|
  Fly    61 IILLLFIGGIVCIAFATL--NWVTDTSRERSDRVWALGIIGALTFIPGSYYVYVLFCIMLN 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066
zf-DHHC 111..252 CDD:279823 7/28 (25%)
CG2611NP_610043.1 DUF872 <93..128 CDD:283547 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.