powered by:
Protein Alignment CG17198 and CG2611
DIOPT Version :9
Sequence 1: | NP_001287532.1 |
Gene: | CG17198 / 43110 |
FlyBaseID: | FBgn0039366 |
Length: | 299 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610043.1 |
Gene: | CG2611 / 35324 |
FlyBaseID: | FBgn0032871 |
Length: | 132 |
Species: | Drosophila melanogaster |
Alignment Length: | 61 |
Identity: | 19/61 - (31%) |
Similarity: | 28/61 - (45%) |
Gaps: | 7/61 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 IFAVLFPAALFCTQVVTVIKNSV---MHDYSDRTYDLGLGNNLTLILGSRRLWT--CLSPN 281
|..:||...:.|....|: |.| ..:.|||.:.||:...||.|.||..::. |:..|
Fly 61 IILLLFIGGIVCIAFATL--NWVTDTSRERSDRVWALGIIGALTFIPGSYYVYVLFCIMLN 119
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17198 | NP_001287532.1 |
zf-DHHC |
43..>176 |
CDD:303066 |
|
zf-DHHC |
111..252 |
CDD:279823 |
7/28 (25%) |
CG2611 | NP_610043.1 |
DUF872 |
<93..128 |
CDD:283547 |
9/27 (33%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5273 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.