DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and GABPI

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:198 Identity:44/198 - (22%)
Similarity:79/198 - (39%) Gaps:74/198 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 MKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGS 172
            |.|:.::   |:||::..|.|::||.:|..|:.:||||..::..|:|..|   ::|:....|: |
  Fly   261 MHGQPNI---CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERN---YVWYIVGLAL-S 318

  Fly   173 AVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRIVSVLGVNIFAVLFP----- 232
            .:||                |:.|| :...:..:|        :.:|..||   :.||.|     
  Fly   319 EIAL----------------LLGAN-LTLTSICHP--------FMVVRPLG---YPVLLPDDCSE 355

  Fly   233 ----------------AALFCTQVVTVI--------KNSVMHDYSDRTYDLGLGNNLTLILGSRR 273
                            |.|..:.:..::        |.|.:|:|. ||.:..         |..|
  Fly   356 VFEGFDLGISFVVACYALLISSYIAFILARQAYLWWKGSTLHEYK-RTSNAA---------GRNR 410

  Fly   274 LWT 276
            :|:
  Fly   411 IWS 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 21/67 (31%)
zf-DHHC 111..252 CDD:279823 36/169 (21%)
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 37/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467562
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.