DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc23

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:153 Identity:40/153 - (26%)
Similarity:68/153 - (44%) Gaps:33/153 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 MQQPMKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYA 168
            :..|.|.:|. |  |..||...|.|:|||.||..|:.:.||||.::.:|||.:|.:.||      
Mouse   240 LDSPAKVKED-W--CAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFI------ 295

  Fly   169 AIGSAVALFDNFMLAHKHGVGF-FDLVKANYIIFNA-YMNPG--------RKELVIFYRIVSVLG 223
                 :|| ..|:|...:|:.. .:.:..:..:|.| :..||        .....::|.::...|
Mouse   296 -----LAL-SIFLLTSVYGISLTLNTICRDRSLFTALFYCPGVYANYSSALSFTCVWYSVIITAG 354

  Fly   224 VNIFAVLFPAALFCTQVVTVIKN 246
            :        |.:|..|::.:..|
Mouse   355 M--------AYIFLIQLINISYN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 25/71 (35%)
zf-DHHC 111..252 CDD:279823 38/146 (26%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 38/145 (26%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.