DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and CG17075

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:139 Identity:33/139 - (23%)
Similarity:62/139 - (44%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IILFFYFFEAFYVMPQFLGLFGQAVHFLVTTWIVYNILENLRLCVT--------TLNTVDSLPPQ 103
            ::|.|.....:.::|.|.......::.|:|...:.:|..:|...:|        .::..|.:.|:
  Fly   120 VLLLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDPADKELRRVHRNDRIVPE 184

  Fly   104 MQQPMKG---EEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFS 165
            ..:....   |....|.|.|  |....|:.||::|:.|:.|.||||.::.:|:|..|     :.:
  Fly   185 FDRSKHSHVIENGRCHLCNI--RTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRN-----YVA 242

  Fly   166 FYAAIGSAV 174
            |...:.|||
  Fly   243 FLMCVVSAV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 33/139 (24%)
zf-DHHC 111..252 CDD:279823 22/64 (34%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.