DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster


Alignment Length:225 Identity:51/225 - (22%)
Similarity:90/225 - (40%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RRVGAIKSWTDIMGVSINVCIILFFYFFEAFYVM--PQFLGLFGQAVHFLVTTWIVYNIL----- 84
            |.:.|..:|     :.:.:...|||::...|||.  |..|...|....|::..:.:...:     
  Fly     9 RYIPATFAW-----IVLLLTTFLFFFYPCQFYVKSHPWVLAYQGVITFFVLANFTLATFMDPGII 68

  Fly    85 ----------ENLRLCVTTLNTVDSLPPQMQQPMKGEEHLWHFCKICQRNVPPRSWHCNICDACI 139
                      |.||..:.....::.:..:|:         |  |..|:...|||..||::|:.||
  Fly    69 PKASPDEDCEEELRAPLYKNAEINGITVKMK---------W--CVTCKFYRPPRCSHCSVCNHCI 122

  Fly   140 LKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFMLAHKHGVGFFDLVKANYIIFNAY 204
            ...||||.:|.||:|..|.|:|.:|....:|               |.:..|.|.    :::...
  Fly   123 ETFDHHCPWVNNCIGRRNYRFFFFFLVSLSI---------------HMLSIFSLC----LVYVLK 168

  Fly   205 MNPGRKE-----LVIFYRIVSVLGVNIFAV 229
            :.|..|:     .:|...:|::|.:.||.:
  Fly   169 IMPNIKDTAPIVAIILMGLVTILAIPIFGL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 38/149 (26%)
zf-DHHC 111..252 CDD:279823 34/124 (27%)
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 35/135 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.