DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc20

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_006252134.1 Gene:Zdhhc20 / 305923 RGDID:1305755 Length:444 Species:Rattus norvegicus


Alignment Length:176 Identity:50/176 - (28%)
Similarity:80/176 - (45%) Gaps:32/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 FCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFM 181
            :|:.||...|.|:.||:.||.|:||.||||.:|.||||..|.::|:.|..|:      .|:..|:
  Rat   186 YCEKCQLIKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFTNYKFFMLFLLYS------LLYCLFV 244

  Fly   182 LAH--KHGVGFFDLVK-----------ANYIIFNAYMNPGRKELVIFYRIVSVLGVNIFAVLFPA 233
            .|.  ::.:.|:.|.:           ...:.|.:...|..|..|:|...||       |:.|.:
  Rat   245 AATVLEYFIKFWTLCRRKSTENCPKNEPTVLTFPSAKFPSAKFHVLFLFFVS-------AMFFVS 302

  Fly   234 --ALFCTQVVTVIKN-SVMHDYSDRTYDLGL-GNNLTLILGSRRLW 275
              :||......|.|| :.:..:....:..|: ||..:  ||..:.|
  Rat   303 VLSLFSYHCWLVGKNRTTIESFRAPMFSYGIDGNGFS--LGCSKNW 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 25/58 (43%)
zf-DHHC 111..252 CDD:279823 44/150 (29%)
Zdhhc20XP_006252134.1 zf-DHHC 75..380 CDD:303066 50/176 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.