DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc9

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:337 Identity:86/337 - (25%)
Similarity:133/337 - (39%) Gaps:91/337 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MQTINIPRRVGAIKSWTDIMGVSINVC--------------IILF--------FYFFEAFYV--- 59
            |..:.|.::|  .:.|..:.|.:...|              :.||        |:.||..|:   
  Rat     1 MSVMVIRKKV--TRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQ 63

  Fly    60 ----MPQF---LGLFGQAVHFLVTTW-----IVYNILENLRLCVTTLNTVDSLPPQMQQP----- 107
                :|.|   |.||..|. .|.|::     |...:.:........:...:...||.|:|     
  Rat    64 LSPAIPVFAAMLFLFSMAT-LLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIK 127

  Fly   108 ---MKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAA 169
               :..:.....:|..|:...|||:.||:|||.|:.:.||||.:||||||..|.|||..|....:
  Rat   128 NFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLS 192

  Fly   170 IGSA-VALFDNFMLAHKH-GVGFFDLVKANYIIFNAYMNPGR--KELVIFYRIVSVLGVNIFAVL 230
            :.:. |..|:...:|.|. .:||.:.:|.         .||.  :.|:.|:.:.||:|:..|.. 
  Rat   193 LLTIYVFAFNIVYVALKSLKIGFLETLKE---------TPGTVLEVLICFFTLWSVVGLTGFHT- 247

  Fly   231 FPAALFCTQVVTVI-----KNSVMHDYSDRTYDLGLGN---NLTLILGSRRLWTC--LSPNIKS- 284
            |..||..|....:.     ||.|.:.||.       ||   |...:|       |  |.|::.. 
  Rat   248 FLVALNQTTNEDIKGSWTGKNRVQNPYSH-------GNIVKNCCEVL-------CGPLPPSVLDR 298

  Fly   285 ----PLPHNGTR 292
                ||..:|:|
  Rat   299 RGILPLEESGSR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 47/178 (26%)
zf-DHHC 111..252 CDD:279823 48/149 (32%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 45/132 (34%)
ANXA2R <284..>343 CDD:292349 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.