DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc3

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_038937239.1 Gene:Zdhhc3 / 301081 RGDID:1309041 Length:350 Species:Rattus norvegicus


Alignment Length:281 Identity:74/281 - (26%)
Similarity:119/281 - (42%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PRRVGAIKSWTDIMGVSINVCIILFFYFFEAFYVMPQFLGLFGQAVHFLVTTWIVYNILENLRL- 89
            |..||.:  |....|..|...|:.:|....|.:|:...:.:..:...:.:...||:|:|..|.| 
  Rat    30 PGPVGTM--WFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYAYSIINGIVFNLLAFLALA 92

  Fly    90 --CVTTLNTVDSLPP--------QMQQPMKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDH 144
              |...|....::|.        :..|...|:  :.:.|..|....|.|:.||::|..||.|.||
  Rat    93 SHCRAMLTDPGAVPKGNATKEFIESLQLKPGQ--VVYKCPKCCSIKPDRAHHCSVCKRCIRKMDH 155

  Fly   145 HCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGR 209
            ||.:|.||||.|||:||:.|:.|.|:.|..||   .|:    |..|....:.::...:::..|..
  Rat   156 HCPWVNNCVGENNQKYFVLFTMYIALISLHAL---IMV----GFHFLHCFEEDWTKCSSFSPPTT 213

  Fly   210 KELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVIKNSVMHDYSDRTYDLGLGNNLTLILGSRRL 274
            ..|:|.....::|     .::|.:.:|.|||.::.        :|.|             |..||
  Rat   214 VILLILLCFEALL-----FLIFTSVMFGTQVHSIC--------TDET-------------GIERL 252

  Fly   275 WTCLSPNIKSPLPHNGTRWKS 295
                 ...|.|...:|: |||
  Rat   253 -----QRSKQPREQSGS-WKS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 44/143 (31%)
zf-DHHC 111..252 CDD:279823 42/140 (30%)
Zdhhc3XP_038937239.1 DHHC 128..253 CDD:396215 47/162 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.