DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and ZDHHC8

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001171953.1 Gene:ZDHHC8 / 29801 HGNCID:18474 Length:778 Species:Homo sapiens


Alignment Length:156 Identity:44/156 - (28%)
Similarity:64/156 - (41%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LFGQAVHFLVTT--WI---------VYN------ILENLRLCV-------TTLNTVDSLPPQMQQ 106
            |.|.:..|.|.|  |:         |||      :|.|..:..       ...:..:......:.
Human    24 LVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLANFSMATFMDPGVFPRADEDEDKEDDFRA 88

  Fly   107 PM------KGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWF- 164
            |:      :|.:....:|..|....|||..||::||.|:...||||.:|.||:|..|.|||..| 
Human    89 PLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFL 153

  Fly   165 -SFYAAIGSAVALFDNFMLAHKHGVG 189
             |..|.:...||....::|.|..|:|
Human   154 LSLSAHMVGVVAFGLVYVLNHAEGLG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 39/141 (28%)
zf-DHHC 111..252 CDD:279823 31/81 (38%)
ZDHHC8NP_001171953.1 DHHC 99..224 CDD:366691 31/81 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..352
PHA03247 <333..771 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.