DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:127 Identity:37/127 - (29%)
Similarity:59/127 - (46%) Gaps:18/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 CKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFML 182
            |.:|..:|..||.||:.|:.|:...||||.::.||||..|.|.|:     .::.||:.       
  Rat   133 CNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLFL-----HSVASALL------- 185

  Fly   183 AHKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVI 244
                ||....|| |.|:....::||.|......:.::. ...:::.|..|||...||...::
  Rat   186 ----GVLLLVLV-ATYVFVEFFVNPMRLRTNQHFEVLK-NHTDVWFVFLPAAPVETQAPAIL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 22/57 (39%)
zf-DHHC 111..252 CDD:279823 37/127 (29%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 37/127 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.