DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and ZDHHC24

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_997223.1 Gene:ZDHHC24 / 254359 HGNCID:27387 Length:284 Species:Homo sapiens


Alignment Length:259 Identity:73/259 - (28%)
Similarity:115/259 - (44%) Gaps:33/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EAFYVM-----PQFLGLFGQAVHFLVTTWIVYNILENLRLCVTTLNTVDSLPPQMQQPM---KGE 111
            |..||:     |..||...:|:...:..:.:.|:|.|:.|.:.:       .|.::..|   :|.
Human    32 ELAYVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRS-------DPSIRGVMLAGRGL 89

  Fly   112 EHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVAL 176
            ...|.:|..||..|||||.||:.|..|||:|||||..:|.|||..|.|.|:....:||   .|.|
Human    90 GQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHAA---GVLL 151

  Fly   177 FDNFMLAHKHGVGFFDLVKANYIIFNA--------YMNPGRKELVIFYRIVSVLGVNIFAVLFPA 233
            ..:.:|    |.....|::|:..:..|        .:..||..|..| .:..|....:...|...
Human   152 HVSVLL----GPALSALLRAHTPLHMAALLLLPWLMLLTGRVSLAQF-ALAFVTDTCVAGALLCG 211

  Fly   234 ALFCTQVVTVIKNSVMHDYS--DRTYDLGLGNNLTLILGSRRLWTCLSPNIKSPLPHNGTRWKS 295
            |......:.:::.....:::  ..:||||..:||...||.|.....|.|.:.||||.:|..:::
Human   212 AGLLFHGMLLLRGQTTWEWARGQHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 44/128 (34%)
zf-DHHC 111..252 CDD:279823 43/148 (29%)
ZDHHC24NP_997223.1 zf-DHHC 95..234 CDD:279823 42/146 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9123
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4820
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47998
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm40467
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.