Sequence 1: | NP_001287532.1 | Gene: | CG17198 / 43110 | FlyBaseID: | FBgn0039366 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659564.3 | Gene: | Zdhhc2 / 246326 | RGDID: | 628681 | Length: | 366 | Species: | Rattus norvegicus |
Alignment Length: | 330 | Identity: | 63/330 - (19%) |
---|---|---|---|
Similarity: | 111/330 - (33%) | Gaps: | 118/330 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 IPRRVGAIKSWTDIMGVSINVCIILFFYFFEAFYVMPQFLG-----LFGQAVHFLVTTWIVYNIL 84
Fly 85 ENLRLCVTTLNTVDSLPPQ-----------MQQPMKGEEH--------------------LWHFC 118
Fly 119 KICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFMLA 183
Fly 184 HKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRI------VSVLGVNIFAVLFPAALFCTQV-- 240
Fly 241 ---------------VTVIKNSVMHDYSDRT-YDLGLGNNLTLILG-SRRLW------------- 275
Fly 276 --TCL 278 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17198 | NP_001287532.1 | zf-DHHC | 43..>176 | CDD:303066 | 37/168 (22%) |
zf-DHHC | 111..252 | CDD:279823 | 40/183 (22%) | ||
Zdhhc2 | NP_659564.3 | DHHC | 19..301 | CDD:418707 | 61/320 (19%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 297..366 | 63/330 (19%) | |||
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000250|UniProtKB:P59267 | 298..366 | ||||
Non-canonical dileucine endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 | 334..335 | ||||
NPxY-like endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 | 357..360 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |