DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_659564.3 Gene:Zdhhc2 / 246326 RGDID:628681 Length:366 Species:Rattus norvegicus


Alignment Length:330 Identity:63/330 - (19%)
Similarity:111/330 - (33%) Gaps:118/330 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IPRRVGAIKSWTDIMGVSINVCIILFFYFFEAFYVMPQFLG-----LFGQAVHFLVTTWIVYNIL 84
            :.||...:..|..::.:|:.:....:.|..:...|..:.:|     |....:.|.:..|..:.  
  Rat     9 VRRRCRRVLYWIPVVFISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHLLFAMFVWSYWK-- 71

  Fly    85 ENLRLCVTTLNTVDSLPPQ-----------MQQPMKGEEH--------------------LWHFC 118
                    |:.|:...|.:           :::..:||.|                    ...:|
  Rat    72 --------TIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYC 128

  Fly   119 KICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFMLA 183
            ..|:...|.|..||::||.||||.||||.:|.||||.:|.::|:.|..|:.:             
  Rat   129 DRCRLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL------------- 180

  Fly   184 HKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRI------VSVLGVNIFAVLFPAALFCTQV-- 240
                          |.:|.|     ..:|..|.|.      .:....:|..:.|.||:|...:  
  Rat   181 --------------YCLFIA-----ATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSS 226

  Fly   241 ---------------VTVIKNSVMHDYSDRT-YDLGLGNNLTLILG-SRRLW------------- 275
                           :...:|.|....:|:. :.||...|:..:.| .::.|             
  Rat   227 LFGYHCWLVSKNKSTLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSQGDGCS 291

  Fly   276 --TCL 278
              |||
  Rat   292 FPTCL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 37/168 (22%)
zf-DHHC 111..252 CDD:279823 40/183 (22%)
Zdhhc2NP_659564.3 DHHC 19..301 CDD:418707 61/320 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..366 63/330 (19%)
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000250|UniProtKB:P59267 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 334..335
NPxY-like endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.