DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001074412.1 Gene:Zdhhc22 / 238331 MGIID:2685108 Length:263 Species:Mus musculus


Alignment Length:274 Identity:66/274 - (24%)
Similarity:100/274 - (36%) Gaps:78/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VCIILFFYFFEAFYVMPQF------LGLFGQAV-HFLVTTWIVYNILENLRLCVTTLNTVDSL-- 100
            :||.|..:..:.|..:|..      ..||..|| |..:..::..|.|.|..|.:.  |:.|.|  
Mouse    16 LCISLVTFVLQLFLFLPSMREDPTATPLFSPAVLHGALFLFLSANALGNYVLVIQ--NSPDDLGT 78

  Fly   101 --PPQMQQPMKGEEHLWHFCKICQRNVPPRSWH-CNICDACILKRDHHCNFVGNCVGHNNQRYFI 162
              ....|:|.            |    ||.|.| |.:|....|:.||||.|.|||:|..|.|.||
Mouse    79 CQGTMSQRPQ------------C----PPPSTHFCRVCSRVTLRHDHHCFFTGNCIGSRNMRNFI 127

  Fly   163 WFSFYAAIG------SAVALFDNFM-LAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRIVS 220
            .|..|.::.      :.||.....: ::..|.:.|..|:..:...|.:               .:
Mouse   128 LFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFS---------------GA 177

  Fly   221 VLGVNIFAVL-----FPAALFCT-----QVVTVIKNSVMHDYSDRTYDLGLG---------NNLT 266
            |||.::|.:|     |...|.|.     |::.:::...       .|.:..|         .||.
Mouse   178 VLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILRGQT-------RYQVRKGMAVRARPWRKNLQ 235

  Fly   267 LILGSRRLWTCLSP 280
            .:.|.|.|...|.|
Mouse   236 EVFGKRWLLGLLVP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 43/148 (29%)
zf-DHHC 111..252 CDD:279823 38/158 (24%)
Zdhhc22NP_001074412.1 DHHC 91..218 CDD:366691 36/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.