DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_659136.1 Gene:Zdhhc5 / 228136 MGIID:1923573 Length:715 Species:Mus musculus


Alignment Length:293 Identity:71/293 - (24%)
Similarity:103/293 - (35%) Gaps:101/293 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GVSINVC------IILFFYFFEAFYVMPQFL--GLFGQAVH-------FLVTTWIVYNILENLRL 89
            |:|:||.      ..:.|.|..|.:.|..|:  |:|.:|..       |...   :|..:|    
Mouse    38 GLSLNVSPAVPIYNAIMFLFVLANFSMATFMDPGIFPRAEEDEDKEDDFRAP---LYKTVE---- 95

  Fly    90 CVTTLNTVDSLPPQMQQPMKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVG 154
                              :||.:....:|..|:...|||..||::||.|:.:.||||.:|.||:|
Mouse    96 ------------------IKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIG 142

  Fly   155 HNNQRYFIWFSFYAAIGSAVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRIV 219
            ..|.|||.             ||...:.||..||..|.|                  |.:.|.|.
Mouse   143 RRNYRYFF-------------LFLLSLTAHIMGVFGFGL------------------LYVLYHIE 176

  Fly   220 SVLGVN---IFAVLFPAALFCTQVVTVIKNSVMHDYSDRT---------------YDLGLGNNLT 266
            .:.||.   ..||:..|.||...|..:....|:.....||               :..|..||::
Mouse   177 ELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVS 241

  Fly   267 LILGSRRLWTCLSPNIKSPLPHNGTRWKSKRAV 299
            .:|.|            ||.|....|.|.::.:
Mouse   242 RVLCS------------SPAPRYLGRPKKEKTI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 37/147 (25%)
zf-DHHC 111..252 CDD:279823 42/143 (29%)
Zdhhc5NP_659136.1 zf-DHHC 99..224 CDD:279823 44/155 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.