Sequence 1: | NP_001287532.1 | Gene: | CG17198 / 43110 | FlyBaseID: | FBgn0039366 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001023033.1 | Gene: | dhhc-4 / 191420 | WormBaseID: | WBGene00014075 | Length: | 405 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 56/198 - (28%) |
---|---|---|---|
Similarity: | 87/198 - (43%) | Gaps: | 27/198 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 MKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWF---SFYAA 169
Fly 170 IGSAVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIF-----YRIVSVLGVNIFAV 229
Fly 230 LFPAALFCTQVVTVIKN--------SVMHD--YSDRTYDLGLGNNLTLILGSRRLWTCLSPNIKS 284
Fly 285 PLP 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17198 | NP_001287532.1 | zf-DHHC | 43..>176 | CDD:303066 | 30/70 (43%) |
zf-DHHC | 111..252 | CDD:279823 | 45/158 (28%) | ||
dhhc-4 | NP_001023033.1 | zf-DHHC | 131..274 | CDD:279823 | 43/145 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |