DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and dhhc-4

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001023033.1 Gene:dhhc-4 / 191420 WormBaseID:WBGene00014075 Length:405 Species:Caenorhabditis elegans


Alignment Length:198 Identity:56/198 - (28%)
Similarity:87/198 - (43%) Gaps:27/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 MKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWF---SFYAA 169
            ::|.:|...||..|....|.||.||::|:.|:||.||||.:|.|||...|.:|||.|   .|...
 Worm   126 VRGFDHGIRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILFLAYGFIFC 190

  Fly   170 IGSAVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIF-----YRIVSVLGVNIFAV 229
            |..|.....:|:...:|.   :|:.|..|...::.:....|.|...     :.:|.:|.::....
 Worm   191 IWIAATTLPSFIDFWRHE---YDMNKKQYDSIDSVIQRNLKHLHTVLSNGRFPLVFLLFLSCMFS 252

  Fly   230 LFPAALFCTQVVTVIKN--------SVMHD--YSDRTYDLGLGNNLTLILGSRRLWTCLSPNIKS 284
            |..:.||...:....||        :.|.|  |:...::.|:..|...|.||..|:..|      
 Worm   253 LSLSFLFFYHLYLTAKNRTTVESFRAPMIDGKYAKDAFNHGIRANYREIFGSHPLYWFL------ 311

  Fly   285 PLP 287
            |:|
 Worm   312 PVP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 30/70 (43%)
zf-DHHC 111..252 CDD:279823 45/158 (28%)
dhhc-4NP_001023033.1 zf-DHHC 131..274 CDD:279823 43/145 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.