DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and dhhc-8

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001370072.1 Gene:dhhc-8 / 176731 WormBaseID:WBGene00012718 Length:471 Species:Caenorhabditis elegans


Alignment Length:159 Identity:45/159 - (28%)
Similarity:68/159 - (42%) Gaps:31/159 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RRVGAIK----SWTDIMGVSINVCIILFFYFFEAFYVMPQFLGLFGQAVHFLVTTWIVYNILENL 87
            :|:.|:.    :|..|:|     |.:.||:|     :.||....:......|:...:|..::.:.
 Worm     3 KRISALLPAAIAWALIIG-----CSVSFFWF-----IAPQIWNQWHTPGLILIAIDVVLFLMVSS 57

  Fly    88 RLCVTTL---------------NTVDSL--PPQMQQPMKGEEHLWHFCKICQRNVPPRSWHCNIC 135
            .|.:..|               ..||.|  |......:.|......:|..|:...||||.||::|
 Worm    58 NLLMAMLLDPAVHPYAIGSEEPTQVDDLRAPLYKNVDINGITVRMKWCVTCKFYRPPRSSHCSVC 122

  Fly   136 DACILKRDHHCNFVGNCVGHNNQRYFIWF 164
            :.||...||||.:|.||||..|.|||.:|
 Worm   123 NRCIETFDHHCPWVHNCVGKRNYRYFFFF 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 40/139 (29%)
zf-DHHC 111..252 CDD:279823 25/54 (46%)
dhhc-8NP_001370072.1 DHHC 98..228 CDD:396215 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.