DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_011245807.1 Gene:Zdhhc15 / 108672 MGIID:1915336 Length:355 Species:Mus musculus


Alignment Length:309 Identity:72/309 - (23%)
Similarity:118/309 - (38%) Gaps:93/309 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IKSWTDIMGVSINVCIILFFYFFEAFYVMPQFLGLFGQAVHFLVTTW-----IVYNILEN---LR 88
            :.||..::   :.|.::|:.|:...|.:.             |||..     ::|.||.:   :.
Mouse    19 VLSWVPVL---VIVLVVLWSYYAYVFELC-------------LVTVLSPAEKVIYLILYHAIFVF 67

  Fly    89 LCVTTLNTVDSLPPQMQQPM----------KGEEH------------------------LWHFCK 119
            ...|...::.:||.|..|..          |.||.                        ...||.
Mouse    68 FAWTYWKSIFTLPQQPNQKFHLSYTDKERYKNEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCD 132

  Fly   120 ICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGS---AVALFDNFM 181
            .|....|.|..||::|..|:||.||||.:|.||:|.:|.::|:.|..|:.:..   |..:|..|:
Mouse   133 RCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFI 197

  Fly   182 LAHKHGVGFFDLVKAN----YIIFNAYMNPGRKELVIFYRIVSVLGVNIFAV---LFPAALFCTQ 239
               |:..|....|::.    :::|.|.|        .|..:|.:.|.:.:.|   ......|||.
Mouse   198 ---KYWRGELPSVRSKFHVLFLLFVACM--------FFVSLVILFGYHCWLVSRNKTTLEAFCTP 251

  Fly   240 VVT--VIKNSVMHDYSDRTYDLGLGNNLTLILG-SRRLWTCLSPNIKSP 285
            |.|  ..||.         ::||...|:..:.| :::.|  |.|...||
Mouse   252 VFTSGPEKNG---------FNLGFIKNIQQVFGDNKKFW--LIPIGSSP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 42/177 (24%)
zf-DHHC 111..252 CDD:279823 45/176 (26%)
Zdhhc15XP_011245807.1 DHHC <126..308 CDD:388695 52/186 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.