DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_598728.1 Gene:Zdhhc7 / 102193 MGIID:2142662 Length:308 Species:Mus musculus


Alignment Length:242 Identity:64/242 - (26%)
Similarity:108/242 - (44%) Gaps:55/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VGAIKSWTDIMGVSINVCIILFFYFFEAFYVMPQFLGLFGQAVHFLVTTWIVYNIL------ENL 87
            |.|:.:|          .::::..|...|.::     |..:...:.|...:::|.|      .:|
Mouse    49 VCAVMTW----------LLVVYADFVVTFVML-----LPSKDFWYSVVNGVLFNCLAVLALSSHL 98

  Fly    88 RLCVT----------TLNTVDSLPPQMQQPMKGEEHLWHFCKICQRNVPPRSWHCNICDACILKR 142
            |..:|          |...::||     |...||  :.:.|..|....|.|:.||:||..||.|.
Mouse    99 RTMLTDPGAVPKGNATKEYMESL-----QLKPGE--VIYKCPKCCCIKPERAHHCSICKRCIRKM 156

  Fly   143 DHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNP 207
            ||||.:|.||||..|||:|:.|:.|.|:.|..||    :|.   |:.|...|:..:...:.:..|
Mouse   157 DHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHAL----ILC---GLQFISCVRGQWTECSDFSPP 214

  Fly   208 GRKELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVIKNSVMHDYSD 254
            ....|::|   :.:.|:..|.  |.|.:|.||:     :|:.:|.::
Mouse   215 ITVILLVF---LCLEGLLFFT--FTAVMFGTQI-----HSICNDETE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 43/148 (29%)
zf-DHHC 111..252 CDD:279823 46/140 (33%)
Zdhhc7NP_598728.1 DHHC 131..258 CDD:366691 46/138 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.