DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and zdhhc14

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_004914695.1 Gene:zdhhc14 / 100489334 XenbaseID:XB-GENE-998053 Length:481 Species:Xenopus tropicalis


Alignment Length:135 Identity:38/135 - (28%)
Similarity:69/135 - (51%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PPQMQQ-PMKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWF 164
            ||:.:: .:.|:.....:|..|:...|||:.||::||.|:.:.||||.:||||||..|.|:|  :
 Frog   141 PPRTKEVVINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFF--Y 203

  Fly   165 SFYAAIGSAVALFDNFMLAH----KHGVGFFDLVK---ANYIIFNAYMNPGRKELVIFYRIVSVL 222
            .|..::.........|::.|    ....||.:.:|   |:.:          :.:|.|:.:.|::
 Frog   204 MFILSLSFLTVFIFAFVITHVILRSQQSGFLNALKDSPASVL----------EAVVCFFSVWSIV 258

  Fly   223 GVNIF 227
            |::.|
 Frog   259 GLSGF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 27/75 (36%)
zf-DHHC 111..252 CDD:279823 35/124 (28%)
zdhhc14XP_004914695.1 DHHC 156..279 CDD:366691 35/120 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.