DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17198 and zdhhc12a

DIOPT Version :9

Sequence 1:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_002663098.1 Gene:zdhhc12a / 100332332 ZFINID:ZDB-GENE-081104-40 Length:270 Species:Danio rerio


Alignment Length:289 Identity:58/289 - (20%)
Similarity:104/289 - (35%) Gaps:95/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GLFGQAVHFLVTTWIVYNIL----ENLRLC--------------VTTLNT--------------- 96
            |...:..| ::.|||:..||    .:||.|              |..|:.               
Zfish     9 GCLVRTAH-VILTWIITLILFLHNTDLRRCQERGDLLQPLVFSSVLLLSVLLYFTVSLMDPGFVL 72

  Fly    97 ---------------VDSLPPQMQQPMKGEEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHC 146
                           ::::.||.|..:|...     |..|....|.|:.||..|..|:.:.||||
Zfish    73 SDSQTETASGDGDEELEAMIPQEQNSIKQRR-----CGYCFLLQPMRARHCKWCKRCVRRFDHHC 132

  Fly   147 NFVGNCVGHNNQRYFIWF---SFYAAIGSAVALFDNFMLAHKHGVGFFDLVKANYIIFNAYMNPG 208
            .::.||||..|.|:|:.:   .|.|......:.:..|:.|......|..         |.:    
Zfish   133 PWIDNCVGELNHRWFLLYLCVQFTAVCWGLQSAWSGFISAPSWQQWFTQ---------NVF---- 184

  Fly   209 RKELVIFYRIVSVLGVNIFAVL----FPAALFCTQVVTVIKNSVMH----DYSDRTYDLGLGNNL 265
               |::.:.:.:|..|.:..:|    :.|::.||....:.::.:::    |..:..:|.|:..| 
Zfish   185 ---LLVAFAVTAVFSVVLLLLLCIHAYLASVNCTTWEFMSRHRILYLKHVDSEENPFDRGVFCN- 245

  Fly   266 TLILGSRRLWT--CLSPNI---KSPLPHN 289
                    ||:  |:...:   |..:.||
Zfish   246 --------LWSFCCVCGTVAWEKMYIRHN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 37/161 (23%)
zf-DHHC 111..252 CDD:279823 32/151 (21%)
zdhhc12aXP_002663098.1 DHHC 104..221 CDD:396215 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.