DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LpR2 and CD320

DIOPT Version :9

Sequence 1:NP_001097928.1 Gene:LpR2 / 43105 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_057663.1 Gene:CD320 / 51293 HGNCID:16692 Length:282 Species:Homo sapiens


Alignment Length:228 Identity:63/228 - (27%)
Similarity:88/228 - (38%) Gaps:92/228 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 SHTCSPEEFACKSGEGECIPLSWMCDQNKDCRDGSDEAQCNRTCRSDEFTCGNGRCIQNRFKCDD 338
            |.:|.|.:|.|:: .|.|:||:|.||::.||.|||||.:|.                        
Human    51 SGSCPPTKFQCRT-SGLCVPLTWRCDRDLDCSDGSDEEECR------------------------ 90

  Fly   339 DDDCGDGSDEKNCGEKAKCGSNFFACKSGPCIPNQWVCDGDSDCRNGED-EMQNCTVSLLNFCQA 402
                     .:.|.:|.:       |...|.:|  ..|.|.|||..|.| :::||:...   |.|
Human    91 ---------IEPCTQKGQ-------CPPPPGLP--CPCTGVSDCSGGTDKKLRNCSRLA---CLA 134

  Fly   403 GEFQCSDRITCLHKSWVCDGEADCPDGEDESQSNCLKVSCRPDQFQCNDQSCIAGHLTCNGKRDC 467
            ||.:|:....|:..:|.|||..||||..||                          |.|      
Human   135 GELRCTLSDDCIPLTWRCDGHPDCPDSSDE--------------------------LGC------ 167

  Fly   468 ADGSDEIMCDISAT----PRTC-------NATT 489
              |::||:.:..||    |.|.       ||||
Human   168 --GTNEILPEGDATTMGPPVTLESVTSLRNATT 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpR2NP_001097928.1 LDLa 193..224 CDD:197566
LDLa 235..267 CDD:197566
LDLa 277..313 CDD:238060 18/35 (51%)
LDLa 356..388 CDD:197566 10/32 (31%)
LDLa 400..432 CDD:197566 14/31 (45%)
LDLa 442..476 CDD:238060 5/33 (15%)
LDLa 484..517 CDD:197566 5/13 (38%)
FXa_inhibition 527..562 CDD:291342
EGF_CA 564..594 CDD:214542
LY 675..715 CDD:214531
LY 717..760 CDD:214531
LY 763..803 CDD:214531
FXa_inhibition 877..918 CDD:291342
CD320NP_057663.1 LDLa 54..89 CDD:238060 18/35 (51%)
LDLa 132..167 CDD:238060 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.