Sequence 1: | NP_001097928.1 | Gene: | LpR2 / 43105 | FlyBaseID: | FBgn0051092 | Length: | 1064 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057663.1 | Gene: | CD320 / 51293 | HGNCID: | 16692 | Length: | 282 | Species: | Homo sapiens |
Alignment Length: | 228 | Identity: | 63/228 - (27%) |
---|---|---|---|
Similarity: | 88/228 - (38%) | Gaps: | 92/228 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 SHTCSPEEFACKSGEGECIPLSWMCDQNKDCRDGSDEAQCNRTCRSDEFTCGNGRCIQNRFKCDD 338
Fly 339 DDDCGDGSDEKNCGEKAKCGSNFFACKSGPCIPNQWVCDGDSDCRNGED-EMQNCTVSLLNFCQA 402
Fly 403 GEFQCSDRITCLHKSWVCDGEADCPDGEDESQSNCLKVSCRPDQFQCNDQSCIAGHLTCNGKRDC 467
Fly 468 ADGSDEIMCDISAT----PRTC-------NATT 489 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LpR2 | NP_001097928.1 | LDLa | 193..224 | CDD:197566 | |
LDLa | 235..267 | CDD:197566 | |||
LDLa | 277..313 | CDD:238060 | 18/35 (51%) | ||
LDLa | 356..388 | CDD:197566 | 10/32 (31%) | ||
LDLa | 400..432 | CDD:197566 | 14/31 (45%) | ||
LDLa | 442..476 | CDD:238060 | 5/33 (15%) | ||
LDLa | 484..517 | CDD:197566 | 5/13 (38%) | ||
FXa_inhibition | 527..562 | CDD:291342 | |||
EGF_CA | 564..594 | CDD:214542 | |||
LY | 675..715 | CDD:214531 | |||
LY | 717..760 | CDD:214531 | |||
LY | 763..803 | CDD:214531 | |||
FXa_inhibition | 877..918 | CDD:291342 | |||
CD320 | NP_057663.1 | LDLa | 54..89 | CDD:238060 | 18/35 (51%) |
LDLa | 132..167 | CDD:238060 | 17/60 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |