DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LpR2 and arr

DIOPT Version :9

Sequence 1:NP_001097928.1 Gene:LpR2 / 43105 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster


Alignment Length:473 Identity:143/473 - (30%)
Similarity:215/473 - (45%) Gaps:105/473 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 GKRDCADGSDEIMCDISATPRTCNATTEFDCGGGLCIPNAKVCNRRKDCPNGEDEPAGKCGINEC 527
            |..:..|.....:.::..||:..|:...:|       |:.:..         ||.|        |
  Fly   321 GSLNALDLQTRELKELIDTPKAPNSVRAWD-------PSLQPY---------EDNP--------C 361

  Fly   528 SSKNGGCMHQCV---NLEVGYRCECHDGYKLGADQHTCVDIDECETPGICSQVCVNEIGAFKCEC 589
            :..||.|.|.|:   |.: |:.|.|..|.||                 |.:..|.|         
  Fly   362 AHNNGNCSHLCLLATNSQ-GFSCACPTGVKL-----------------ISANTCAN--------- 399

  Fly   590 EAGYMRLLKNHTRCKASEGHASLLLARRHDIRKIALDRPEMTSI---VNSTKAATALDFVFRTGM 651
              |...:               :.:.:|..|.||:||.|:.|..   :...|.|.|:|:......
  Fly   400 --GSQEM---------------MFIVQRTQISKISLDSPDYTIFPLPLGKVKYAIAIDYDPVEEH 447

  Fly   652 IFWSDVATQSIYKAPIDEGNDRTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMG 716
            |:||||.|.:|.:|..| |...|..:|......||||:||:..::|:|||....||:...:|:..
  Fly   448 IYWSDVETYTIKRAHAD-GTGVTDFVTSEVRHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTAR 511

  Fly   717 KVLVKDSLDIPRSIALDPIEGWMYWSDWG-ASPRIERAGMDGTHRTAIITYDVKWPNGITLDLVQ 780
            |||:.:.|:.||:||:.|..|||:||||. ..|::|||.:||:.|..:::.::.|||||.||:..
  Fly   512 KVLIYEHLEEPRAIAVAPSLGWMFWSDWNERKPKVERASLDGSERVVLVSENLGWPNGIALDIEA 576

  Fly   781 KRLYWVDGKLNTISSSNYDGSQRHQVLYSGEYLRHPFSITTFEDYVYWTDWDKQAVFKANKFNGM 845
            |.:||.|||.:.|..:|.|||.|..|:  .:.|:|.|.::..:||:|||||.::::.:|:|..| 
  Fly   577 KAIYWCDGKTDKIEVANMDGSGRRVVI--SDNLKHLFGLSILDDYLYWTDWQRRSIDRAHKITG- 638

  Fly   846 DVEPVTATHMLEHPMVVHVYHP---------YRQPDGVNHCQSVNGHCSHLCLPAPRINERSPRI 901
                       .:.:||...:|         .|:..|.|.|...||.||||||..||      ..
  Fly   639 -----------NNRIVVVDQYPDLMGLKVTRLREVRGQNACAVRNGGCSHLCLNRPR------DY 686

  Fly   902 SCACPTGLKLMPDGLMCV 919
            .|.|....:|..|...||
  Fly   687 VCRCAIDYELANDKRTCV 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpR2NP_001097928.1 LDLa 193..224 CDD:197566
LDLa 235..267 CDD:197566
LDLa 277..313 CDD:238060
LDLa 356..388 CDD:197566
LDLa 400..432 CDD:197566
LDLa 442..476 CDD:238060 2/12 (17%)
LDLa 484..517 CDD:197566 4/32 (13%)
FXa_inhibition 527..562 CDD:291342 13/37 (35%)
EGF_CA 564..594 CDD:214542 4/29 (14%)
LY 675..715 CDD:214531 14/39 (36%)
LY 717..760 CDD:214531 22/43 (51%)
LY 763..803 CDD:214531 18/39 (46%)
FXa_inhibition 877..918 CDD:291342 15/40 (38%)
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 62/250 (25%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320 2/17 (12%)
NHL repeat 341..419 CDD:271320 27/145 (19%)
NHL repeat 428..476 CDD:271320 16/48 (33%)
LY 472..511 CDD:214531 14/38 (37%)
NHL repeat 477..503 CDD:271320 11/25 (44%)
Ldl_recept_b 534..573 CDD:278487 17/38 (45%)
LY 558..599 CDD:214531 18/40 (45%)
LY 600..641 CDD:214531 14/54 (26%)
FXa_inhibition 668..703 CDD:291342 15/40 (38%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461696
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.