DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LpR2 and LRP6

DIOPT Version :9

Sequence 1:NP_001097928.1 Gene:LpR2 / 43105 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_002327.2 Gene:LRP6 / 4040 HGNCID:6698 Length:1613 Species:Homo sapiens


Alignment Length:309 Identity:132/309 - (42%)
Similarity:187/309 - (60%) Gaps:10/309 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   612 LLLARRHDIRKI--ALDRPEMTSIVNSTKAATALDFVFRTGMIFWSDVATQSIYKAPIDEGNDRT 674
            ||.|.|.|:|.:  ...:...|.:|...:.|.|:||||..|:|:||||:.::|.:...::.....
Human    23 LLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQ 87

  Fly   675 VVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWM 739
            .|:....::.||||.||:...:|:||:....||::|.:||:.|||....||.||:|||||..|:|
Human    88 NVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFM 152

  Fly   740 YWSDWGASPRIERAGMDGTHRTAIITYDVKWPNGITLDLVQKRLYWVDGKLNTISSSNYDGSQRH 804
            ||:|||..|:||||||||:.|..||..::.||||:|||..:::|||.|.|||.|..||.||:.|.
Human   153 YWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQ 217

  Fly   805 QVLYSGEYLRHPFSITTFEDYVYWTDWDKQAVFKANKFNGMDVEPVTATHMLEHPMVVHVYHPYR 869
            .|:...  |.|||::|.|||.:|||||...::...||:.|..:..:.:.  :..||.:|.:...|
Human   218 AVVKGS--LPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSD--IFSPMDIHAFSQQR 278

  Fly   870 QPDGVNHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMPDGLMC 918
            ||:..|.|...||.||||||.:|    ..|...||||||:||:.:|..|
Human   279 QPNATNPCGIDNGGCSHLCLMSP----VKPFYQCACPTGVKLLENGKTC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpR2NP_001097928.1 LDLa 193..224 CDD:197566
LDLa 235..267 CDD:197566
LDLa 277..313 CDD:238060
LDLa 356..388 CDD:197566
LDLa 400..432 CDD:197566
LDLa 442..476 CDD:238060
LDLa 484..517 CDD:197566
FXa_inhibition 527..562 CDD:291342
EGF_CA 564..594 CDD:214542
LY 675..715 CDD:214531 14/39 (36%)
LY 717..760 CDD:214531 28/42 (67%)
LY 763..803 CDD:214531 21/39 (54%)
FXa_inhibition 877..918 CDD:291342 20/40 (50%)
LRP6NP_002327.2 Beta-propeller 1 20..275 107/255 (42%)
NHL 55..272 CDD:302697 97/220 (44%)
NHL repeat 55..93 CDD:271320 13/37 (35%)
LY 89..127 CDD:214531 13/37 (35%)
NHL repeat 97..132 CDD:271320 15/34 (44%)
NHL repeat 140..176 CDD:271320 24/35 (69%)
Ldl_recept_b 150..190 CDD:278487 24/39 (62%)
LY 175..216 CDD:214531 21/40 (53%)
NHL repeat 181..217 CDD:271320 19/35 (54%)
NHL repeat 226..253 CDD:271320 13/26 (50%)
LDL-receptor class B 5 237..276 11/40 (28%)
FXa_inhibition 286..323 CDD:291342 20/40 (50%)
Beta-propeller 2 328..589
LY 353..393 CDD:214531
LY 397..437 CDD:214531
LY 438..481 CDD:214531
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:291342
Beta-propeller 3 631..890
LY 656..694 CDD:214531
LY 697..739 CDD:214531
LY 740..783 CDD:214531
LY 783..825 CDD:214531
LY 827..866 CDD:214531
FXa_inhibition 893..929 CDD:291342
Beta-propeller 4 933..1202
LY 958..998 CDD:214531
Ldl_recept_b 1069..1110 CDD:278487
LY 1094..1136 CDD:214531
FXa_inhibition 1207..1243 CDD:291342
LDLa 1249..1285 CDD:238060
LDLa 1288..1322 CDD:238060
LDLa 1326..1360 CDD:238060
PPPSP motif A 1487..1493
PPPSP motif B 1527..1534
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1556..1613
PPPSP motif C 1568..1575
PPPSP motif D 1588..1593
PPPSP motif E 1603..1610
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.