DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LpR2 and cue

DIOPT Version :9

Sequence 1:NP_001097928.1 Gene:LpR2 / 43105 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster


Alignment Length:364 Identity:87/364 - (23%)
Similarity:142/364 - (39%) Gaps:90/364 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 DIRKIALDRPEMTSIVNSTKAATALDFVFRTGMIFWSDVATQSIYKAPIDEGNDRTVVLTKSSVT 683
            ::..:..|..|.....|..|......|..:..:|..:.||.|:|.:.    ||:          :
  Fly    60 ELSALTFDESEELIYFNDLKHRNGSIFSLKRDLIAANHVAEQTIART----GNE----------S 110

  Fly   684 SDGLAVDWIYNHVYFTDTHKCTIELTNFEGS-MGKVLVKDSLD--IPRSIALDPIEGWMYWSDWG 745
            ..|||.|.:..:::::||.:..|......|| ..:|||..|.:  .|..:|:|.....:||::..
  Fly   111 VGGLAYDPLNMNLFWSDTEQRKIFFAPIHGSATPQVLVDLSAEGGRPDGVAVDVCRRKLYWTNSN 175

  Fly   746 AS-PRIERAGMDGTHRTAIITYDVKWPNGITLDLVQKRLYWVD---GKLNTISSSNYDGSQRHQV 806
            .: |.:||..:||::||.||:.::..|.||.:|.:..||:|:|   |...::.||..|||.|..|
  Fly   176 VTHPTVERINLDGSNRTVIISSNIDMPRGIVVDQLSDRLFWIDDLKGVFFSVESSKLDGSDRQVV 240

  Fly   807 LYSGEYLRHPFSITTFEDYVYWTD------WD--KQAVFKANKFNGMDVEPVTATHMLEHP---- 859
            |....:  .|.::....|.:||||      |.  |..|.|....:..|.|..|.:...:.|    
  Fly   241 LKDKHH--EPLNLAVTNDAIYWTDRTTRAVWSHPKVPVIKVTTTSKPDEEDSTDSTDFKDPEPVA 303

  Fly   860 ---MVVHVYHPYRQPDGV-------------NHCQSVNGHCSHLCLPAPRINERSPRIS------ 902
               .:|.|.:...:..|:             :||.|:......      |::|:|.:..      
  Fly   304 EDCPLVRVANLSEEARGIVARTGFYQRLQKDHHCASIVRKVKE------RVDEQSRKFEIRSLLD 362

  Fly   903 -----------------------CACPTGLKLMPDGLMC 918
                                   |.||||.|    |..|
  Fly   363 QKIKVLEDERCMNDGEYRAATDLCICPTGFK----GSRC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpR2NP_001097928.1 LDLa 193..224 CDD:197566
LDLa 235..267 CDD:197566
LDLa 277..313 CDD:238060
LDLa 356..388 CDD:197566
LDLa 400..432 CDD:197566
LDLa 442..476 CDD:238060
LDLa 484..517 CDD:197566
FXa_inhibition 527..562 CDD:291342
EGF_CA 564..594 CDD:214542
LY 675..715 CDD:214531 9/40 (23%)
LY 717..760 CDD:214531 14/45 (31%)
LY 763..803 CDD:214531 16/42 (38%)
FXa_inhibition 877..918 CDD:291342 12/69 (17%)
cueNP_612113.2 LY 101..141 CDD:214531 11/53 (21%)
Ldl_recept_b 167..208 CDD:278487 14/40 (35%)
LY 193..237 CDD:214531 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461679
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.