DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LpR2 and CG6553

DIOPT Version :9

Sequence 1:NP_001097928.1 Gene:LpR2 / 43105 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster


Alignment Length:163 Identity:60/163 - (36%)
Similarity:80/163 - (49%) Gaps:25/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 HFGSSINSVLNGNPLKFLNVSGKIGTPLDISLGLSN--YCDEKQFQCSTGECIPIRFVCDGSSDC 218
            |...||..|:      ||:::      :.|.||..|  .|..:   |..|:||.:..:||||::|
  Fly     5 HQNLSIQLVI------FLSLA------VTICLGSQNATSCGHR---CGGGDCIQLDQLCDGSANC 54

  Fly   219 PDHSDERLEECKFTESTCSQEQFRCGNGKCIPRRWVCDRENDCADGSDESTSQCRSH----TCSP 279
            .|.|||.:..|:  :..|....|||..|.||....|||...||.|||||....||:.    .|..
  Fly    55 LDGSDETVAMCE--KVWCPGYAFRCSYGACIASTAVCDGVQDCVDGSDEQGWLCRAQMQQANCDN 117

  Fly   280 EEFACKSGEGECIPLSWMCDQNKDCRDGSDEAQ 312
            .|..|.|  |:|:..|.:||..:|||||.||.:
  Fly   118 WEMYCSS--GQCMTYSKLCDGIRDCRDGDDELE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpR2NP_001097928.1 LDLa 193..224 CDD:197566 12/30 (40%)
LDLa 235..267 CDD:197566 15/31 (48%)
LDLa 277..313 CDD:238060 16/36 (44%)
LDLa 356..388 CDD:197566
LDLa 400..432 CDD:197566
LDLa 442..476 CDD:238060
LDLa 484..517 CDD:197566
FXa_inhibition 527..562 CDD:291342
EGF_CA 564..594 CDD:214542
LY 675..715 CDD:214531
LY 717..760 CDD:214531
LY 763..803 CDD:214531
FXa_inhibition 877..918 CDD:291342
CG6553NP_610911.1 LDLa 34..60 CDD:197566 11/28 (39%)
LDLa 70..101 CDD:197566 15/30 (50%)
LDLa 115..146 CDD:197566 14/32 (44%)
Frag1 <260..>303 CDD:287278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.