DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LpR2 and Lrp5

DIOPT Version :9

Sequence 1:NP_001097928.1 Gene:LpR2 / 43105 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_001099791.2 Gene:Lrp5 / 293649 RGDID:1309329 Length:1600 Species:Rattus norvegicus


Alignment Length:321 Identity:131/321 - (40%)
Similarity:189/321 - (58%) Gaps:13/321 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 CKASEGHAS--LLLARRHDIRKIALD--RPEMTSIVNSTKAATALDFVFRTGMIFWSDVATQSIY 663
            |......||  ||.|.|.|:|.:...  :.|.|.:.:..:.|.|:||.|..|.::|:||:.::|.
  Rat    24 CSLVPAAASPLLLFANRRDVRLVDAGGVKLESTIVASGLEDAAAVDFQFSKGAVYWTDVSEEAIK 88

  Fly   664 KAPIDE-GNDRTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIP 727
            :..::: |.....::....|:.||||.||:...:|:||:....||:.|..|:..|||....||.|
  Rat    89 QTYLNQTGAAAQNIVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQP 153

  Fly   728 RSIALDPIEGWMYWSDWGASPRIERAGMDGTHRTAIITYDVKWPNGITLDLVQKRLYWVDGKLNT 792
            |:|||||..|:|||:|||.:||||||||||:.|..|:..|:.||||:|:||.:::|||.|.||:.
  Rat   154 RAIALDPAHGYMYWTDWGEAPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSF 218

  Fly   793 ISSSNYDGSQRHQVLYSGEYLRHPFSITTFEDYVYWTDWDKQAVFKANKFNGMDVEPVTATHMLE 857
            |..:|.|||.|.:|:...  |.|||::|...|.:|||||..:::...||:.|...:.:.:.  |.
  Rat   219 IHRANLDGSFRQKVVEGS--LTHPFALTLSGDTLYWTDWQTRSIHACNKWTGEKRKEILSA--LY 279

  Fly   858 HPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMPDGLMC 918
            .||.:.|....|||.....|:..||.||||||.:|    |.|..|||||||::|..:|..|
  Rat   280 SPMDIQVLSQERQPPFHTPCEEGNGGCSHLCLLSP----REPFYSCACPTGVQLQDNGKTC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpR2NP_001097928.1 LDLa 193..224 CDD:197566
LDLa 235..267 CDD:197566
LDLa 277..313 CDD:238060
LDLa 356..388 CDD:197566
LDLa 400..432 CDD:197566
LDLa 442..476 CDD:238060
LDLa 484..517 CDD:197566
FXa_inhibition 527..562 CDD:291342
EGF_CA 564..594 CDD:214542
LY 675..715 CDD:214531 14/39 (36%)
LY 717..760 CDD:214531 29/42 (69%)
LY 763..803 CDD:214531 20/39 (51%)
FXa_inhibition 877..918 CDD:291342 21/40 (53%)
Lrp5NP_001099791.2 NHL <37..>169 CDD:302697 47/131 (36%)
NHL repeat 65..104 CDD:271320 11/38 (29%)
LY 102..142 CDD:214531 14/39 (36%)
NHL repeat 107..148 CDD:271320 17/40 (43%)
Ldl_recept_b 163..203 CDD:278487 25/39 (64%)
LY 187..229 CDD:214531 20/41 (49%)
LY 230..271 CDD:214531 15/42 (36%)
FXa_inhibition 299..336 CDD:291342 21/40 (53%)
LY 366..406 CDD:214531
LY 408..450 CDD:214531
LY 451..494 CDD:214531
LY 495..537 CDD:214531
LY 538..571 CDD:214531
FXa_inhibition 605..640 CDD:291342
NHL 685..878 CDD:302697
LY 710..752 CDD:214531
NHL repeat 720..756 CDD:271320
NHL repeat 763..802 CDD:271320
NHL repeat 808..843 CDD:271320
NHL repeat 847..871 CDD:271320
FXa_inhibition 906..941 CDD:291342
LY 1060..1103 CDD:214531
LY 1104..1146 CDD:214531
FXa_inhibition 1217..1253 CDD:291342
LDLa 1259..1295 CDD:238060
LDLa 1321..1355 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.