Sequence 1: | NP_001097928.1 | Gene: | LpR2 / 43105 | FlyBaseID: | FBgn0051092 | Length: | 1064 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005267567.1 | Gene: | LRP10 / 26020 | HGNCID: | 14553 | Length: | 721 | Species: | Homo sapiens |
Alignment Length: | 360 | Identity: | 88/360 - (24%) |
---|---|---|---|
Similarity: | 116/360 - (32%) | Gaps: | 125/360 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 CSQEQFRCGNGKCIPRRWVCDRENDCADGSDESTSQCRSHTCSPEEF------------------ 282
Fly 283 --------------ACKSGEGECIPLSWMCDQNKDCR-------------------DGSDEAQCN 314
Fly 315 RTCRS-DEFTCG----------------------NGRCIQNRFKCDD-----DDDCGDGSD---E 348
Fly 349 KNCGEKAKCGSNFFACKSGPCIPNQWVCDGDSDCRNGEDEMQNCTVSLLNFCQAGEFQC-----S 408
Fly 409 DRITCLHKSWVCDGEADCPDGEDESQSNCLKVSCRPDQFQCNDQSCIAGHLTCNGKRDCADGSDE 473
Fly 474 IMCDISATPR---TCNATTEFDCGGGLCIPNAKVC 505 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LpR2 | NP_001097928.1 | LDLa | 193..224 | CDD:197566 | |
LDLa | 235..267 | CDD:197566 | 13/30 (43%) | ||
LDLa | 277..313 | CDD:238060 | 11/86 (13%) | ||
LDLa | 356..388 | CDD:197566 | 7/31 (23%) | ||
LDLa | 400..432 | CDD:197566 | 10/36 (28%) | ||
LDLa | 442..476 | CDD:238060 | 16/33 (48%) | ||
LDLa | 484..517 | CDD:197566 | 6/22 (27%) | ||
FXa_inhibition | 527..562 | CDD:291342 | |||
EGF_CA | 564..594 | CDD:214542 | |||
LY | 675..715 | CDD:214531 | |||
LY | 717..760 | CDD:214531 | |||
LY | 763..803 | CDD:214531 | |||
FXa_inhibition | 877..918 | CDD:291342 | |||
LRP10 | XP_005267567.1 | CUB | 34..134 | CDD:238001 | |
LDLa | 148..182 | CDD:238060 | 15/40 (38%) | ||
CUB | 200..310 | CDD:238001 | 16/112 (14%) | ||
LDLa | <338..361 | CDD:238060 | 9/37 (24%) | ||
LDLa | 407..441 | CDD:238060 | 16/33 (48%) | ||
PRK04654 | <581..683 | CDD:135173 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |