DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LpR2 and F32E10.8

DIOPT Version :9

Sequence 1:	NP_001097928.1	Gene:	LpR2 / 43105	FlyBaseID:	FBgn0051092	Length:	1064	Species:	Drosophila melanogaster
Sequence 2:	NP_501228.1	Gene:	F32E10.8 / 260105	WormBaseID:	WBGene00017995	Length:	134	Species:	Caenorhabditis elegans

Alignment Length:	130	Identity:	44/130 - (33%)
Similarity:	58/130 - (44%)	Gaps:	33/130 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   392 CTVSLLNFCQA-GEFQCSDRITCLHKSWVCDGEADCPDGEDESQSNCLK---------------V 440
            ||..|...|.: ...:|.|::||:.|||:|||:.||||..||..:.|||               :
Worm    19 CTTQLFARCPSLTHIRCFDQLTCIRKSWMCDGKIDCPDHSDELPNICLKRNSYNKLQLQDVSVGL 83

  Fly   441 SCRPDQFQCND-QSCIAGHLTCNGKRDCADGSDEIMCDISATPRTCNATTEFDCGGGLCIPNAKV 504
            .|....|:|.| .||||.:..|:..:||.|||||                ..:|...|..||..|
Worm    84 KCPSFWFRCTDSSSCIAPNRVCDKYKDCRDGSDE----------------RENCNQPLGTPNTTV 132

Fly 505 504
Worm 133 132

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LpR2	NP_001097928.1	LDLa	193..224	CDD:197566
		LDLa	235..267	CDD:197566
		LDLa	277..313	CDD:238060
		LDLa	356..388	CDD:197566
		LDLa	400..432	CDD:197566	15/32 (47%)
		LDLa	442..476	CDD:238060	16/34 (47%)
		LDLa	484..517	CDD:197566	5/21 (24%)
		FXa_inhibition	527..562	CDD:291342
		EGF_CA	564..594	CDD:214542
		LY	675..715	CDD:214531
		LY	717..760	CDD:214531
		LY	763..803	CDD:214531
		FXa_inhibition	877..918	CDD:291342
F32E10.8	NP_501228.1	LDLa	<40..61	CDD:238060	13/20 (65%)
F32E10.8	NP_501228.1	LDLa	84..117	CDD:197566	14/32 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810