DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LpR2 and Ldlrad3

DIOPT Version :9

Sequence 1:NP_001097928.1 Gene:LpR2 / 43105 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_849217.2 Gene:Ldlrad3 / 241576 MGIID:2138856 Length:345 Species:Mus musculus


Alignment Length:123 Identity:53/123 - (43%)
Similarity:72/123 - (58%) Gaps:8/123 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 QCNRTCRSDEFTCGNGRCIQNRFKCDDDDDCGDGSDEKNCGE-KAKCGSNFFACKSG-PCIPNQW 374
            :||   ....|.|.|||||...::||...||.|.||||.|.: |:|||..||.|.|| .||..::
Mouse    28 ECN---IPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSKCGPTFFPCASGIHCIIGRF 89

  Fly   375 VCDGDSDCRNGEDEMQNCTVSLLNFCQAGEFQCSDRITCLHKSWVCDGEADCPDGEDE 432
            .|:|..||.:|.|| :|||.:.| .|....:.|.:.: |:.||::|||:.:|.|..||
Mouse    90 RCNGFEDCPDGSDE-ENCTANPL-LCSTARYHCRNGL-CIDKSFICDGQNNCQDNSDE 144

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
LpR2NP_001097928.1 LDLa 193..224 CDD:197566
LDLa 235..267 CDD:197566