DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LpR2 and LDLRAD3

DIOPT Version :10

Sequence 1:NP_001097928.1 Gene:LpR2 / 43105 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_777562.1 Gene:LDLRAD3 / 143458 HGNCID:27046 Length:345 Species:Homo sapiens


Alignment Length:137 Identity:56/137 - (40%)
Similarity:75/137 - (54%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 QCNRTCRSDEFTCGNGRCIQNRFKCDDDDDCGDGSDEKNCGE-KAKCGSNFFACKSG-PCIPNQW 374
            :||   ....|.|.|||||...::||...||.|.||||.|.: |:|||..||.|.|| .||..::
Human    28 ECN---IPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSKCGPTFFPCASGIHCIIGRF 89

  Fly   375 VCDGDSDCRNGEDEMQNCTVSLLNFCQAGEFQCSDRITCLHKSWVCDGEADCPDGEDESQSNCLK 439
            .|:|..||.:|.|| :|||.:.| .|....:.|.:.: |:.||::|||:.:|.|..||.      
Human    90 RCNGFEDCPDGSDE-ENCTANPL-LCSTARYHCKNGL-CIDKSFICDGQNNCQDNSDEE------ 145

  Fly   440 VSCRPDQ 446
             ||...|
Human   146 -SCESSQ 151

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
LpR2NP_001097928.1 LDLa 193..224 CDD:197566
LDLa 235..267 CDD:197566