DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27 and RPL14

DIOPT Version :9

Sequence 1:NP_001262966.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001030168.1 Gene:RPL14 / 9045 HGNCID:10305 Length:215 Species:Homo sapiens


Alignment Length:44 Identity:13/44 - (29%)
Similarity:20/44 - (45%) Gaps:7/44 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAG 45
            |:.::.|::..|..|.:||:...||...|.       ..|||.|
Human     4 RRFVEVGRVAYVSFGPHAGKLVAIVDVIDQ-------NRALVDG 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27NP_001262966.1 KOW 1..135 CDD:412330 13/44 (30%)
RPL14NP_001030168.1 Ribosomal_L14e 2..128 CDD:421510 13/44 (30%)
valS <123..210 CDD:237855
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..215
4 X 5 AA tandem repeats of Q-K-A-[PAS]-X 171..190
2 X 3 AA tandem repeats of K-[GA]-Q 193..198
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.