DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27 and RPL6A

DIOPT Version :9

Sequence 1:NP_001262966.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_013638.1 Gene:RPL6A / 854902 SGDID:S000004538 Length:176 Species:Saccharomyces cerevisiae


Alignment Length:130 Identity:32/130 - (24%)
Similarity:52/130 - (40%) Gaps:32/130 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGT-----PEKPFGHALVAGIDRYPRKVTKKM--- 57
            :|..:..|.::|:|:||:.|::.:.:|..:|.|     |.|..|..|.....||....:.|:   
Yeast    30 LRASLVPGTVLILLAGRFRGKRVVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVE 94

  Fly    58 ------------GKNKLKKKSKVKPFLKSLNYNHLMPTRYT----AHDISFEKLSPKDLKDPVKR 106
                        .|.||.||.|     |..|   |.|.:..    |..:..:|:..|.|...:|:
Yeast    95 GVNVEKFNVEYFAKEKLTKKEK-----KEAN---LFPEQQNKEIKAERVEDQKVVDKALIAEIKK 151

  Fly   107  106
            Yeast   152  151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27NP_001262966.1 KOW 1..135 CDD:412330 32/130 (25%)
RPL6ANP_013638.1 KOW_RPL6 26..176 CDD:240520 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.