DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27 and RPL27B

DIOPT Version :9

Sequence 1:NP_001262966.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_010759.1 Gene:RPL27B / 852082 SGDID:S000002879 Length:136 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:70/136 - (51%)
Similarity:98/136 - (72%) Gaps:1/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAGIDRYPRKVTKKMGKNKLKKK 65
            |.|.:|.||:.:|:.|||||:|.:|||.||:|:...||||||||||:|||.|||||.|..|:.|:
Yeast     1 MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKSHPFGHALVAGIERYPSKVTKKHGAKKVAKR 65

  Fly    66 SKVKPFLKSLNYNHLMPTRYTAHDISFEK-LSPKDLKDPVKRKTHRFQTRVKFESVYKEGKNKWF 129
            :|:|||:|.:|||||:|||||....:|:. :|.:..:.|.:|:..:...:..||..::.|||:||
Yeast    66 TKIKPFIKVVNYNHLLPTRYTLDVEAFKSVVSTETFEQPSQREEAKKVVKKAFEERHQAGKNQWF 130

  Fly   130 FQKLRF 135
            |.||||
Yeast   131 FSKLRF 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27NP_001262966.1 KOW 1..135 CDD:412330 68/134 (51%)
RPL27BNP_010759.1 KOW 1..136 CDD:294253 68/134 (51%)
RPL14A 1..128 CDD:225074 62/126 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346037
Domainoid 1 1.000 83 1.000 Domainoid score I1939
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105144
Inparanoid 1 1.050 152 1.000 Inparanoid score I1112
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53799
OrthoFinder 1 1.000 - - FOG0001918
OrthoInspector 1 1.000 - - otm46961
orthoMCL 1 0.900 - - OOG6_101266
Panther 1 1.100 - - O PTHR10497
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1122
SonicParanoid 1 1.000 - - X1272
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.