DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27 and RPL27

DIOPT Version :9

Sequence 1:NP_001262966.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_000979.1 Gene:RPL27 / 6155 HGNCID:10328 Length:136 Species:Homo sapiens


Alignment Length:137 Identity:85/137 - (62%)
Similarity:106/137 - (77%) Gaps:3/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAGIDRYPRKVTKKMGKNKLKKK 65
            |.|.||.||:|:||:|||:||||:|||..||||.::|:.|||||||||||||||..|||.|:.|:
Human     1 MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKR 65

  Fly    66 SKVKPFLKSLNYNHLMPTRYTAHDISFEK-LSPKDL-KDPVKRKTHRFQTRVKFESVYKEGKNKW 128
            ||:|.|:|..||||||||||:. ||..:| :..||: :||..::..|.:.:||||..||.|||||
Human    66 SKIKSFVKVYNYNHLMPTRYSV-DIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKNKW 129

  Fly   129 FFQKLRF 135
            |||||||
Human   130 FFQKLRF 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27NP_001262966.1 KOW 1..135 CDD:412330 83/135 (61%)
RPL27NP_000979.1 KOW 1..136 CDD:412330 83/135 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158706
Domainoid 1 1.000 95 1.000 Domainoid score I7466
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105144
Inparanoid 1 1.050 170 1.000 Inparanoid score I4115
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53799
OrthoDB 1 1.010 - - D1584965at2759
OrthoFinder 1 1.000 - - FOG0001918
OrthoInspector 1 1.000 - - oto91706
orthoMCL 1 0.900 - - OOG6_101266
Panther 1 1.100 - - LDO PTHR10497
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1122
SonicParanoid 1 1.000 - - X1272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.