DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27 and Rpl27l2

DIOPT Version :10

Sequence 1:NP_651417.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001102806.1 Gene:Rpl27l2 / 502353 RGDID:1561870 Length:102 Species:Rattus norvegicus


Alignment Length:98 Identity:39/98 - (39%)
Similarity:57/98 - (58%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EKPFGHALVAGIDRYPRKVTKKMGKNKLKKKSKVKPFLKSLNYNHLMPTRYTAHDISFEK--LSP 97
            :.|:..|.||.|..|||:....:.|.|..|:|::|.|::..|||||.|||... ||..:|  ::.
  Rat     6 DNPYNSARVAEIGHYPREEKTTLSKKKTVKRSEIKSFVRVENYNHLRPTRCPV-DIPLDKTVVNK 69

  Fly    98 KDLKDPVKRKTHRFQTRVKFESVYKEGKNKWFF 130
            ...:||..:...|::.:||||...|.|:|||||
  Rat    70 NIFRDPALKCKARWEAKVKFEDPLKTGRNKWFF 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27NP_651417.1 KOW 1..135 CDD:469738 39/98 (40%)
Rpl27l2NP_001102806.1 Ribosomal_L27e 28..102 CDD:460322 29/74 (39%)

Return to query results.
Submit another query.