DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27 and RGD1561870

DIOPT Version :9

Sequence 1:NP_001262966.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001102806.1 Gene:RGD1561870 / 502353 RGDID:1561870 Length:102 Species:Rattus norvegicus


Alignment Length:98 Identity:39/98 - (39%)
Similarity:57/98 - (58%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EKPFGHALVAGIDRYPRKVTKKMGKNKLKKKSKVKPFLKSLNYNHLMPTRYTAHDISFEK--LSP 97
            :.|:..|.||.|..|||:....:.|.|..|:|::|.|::..|||||.|||... ||..:|  ::.
  Rat     6 DNPYNSARVAEIGHYPREEKTTLSKKKTVKRSEIKSFVRVENYNHLRPTRCPV-DIPLDKTVVNK 69

  Fly    98 KDLKDPVKRKTHRFQTRVKFESVYKEGKNKWFF 130
            ...:||..:...|::.:||||...|.|:|||||
  Rat    70 NIFRDPALKCKARWEAKVKFEDPLKTGRNKWFF 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27NP_001262966.1 KOW 1..135 CDD:412330 39/98 (40%)
RGD1561870NP_001102806.1 Ribosomal_L27e 28..102 CDD:396371 29/74 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352720
Domainoid 1 1.000 95 1.000 Domainoid score I7206
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53799
OrthoDB 1 1.010 - - D1584965at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101266
Panther 1 1.100 - - O PTHR10497
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.