DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL27 and RGD1563835

DIOPT Version :9

Sequence 1:NP_001262966.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster
Sequence 2:XP_038944828.1 Gene:RGD1563835 / 498085 RGDID:1563835 Length:135 Species:Rattus norvegicus


Alignment Length:137 Identity:81/137 - (59%)
Similarity:103/137 - (75%) Gaps:4/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAGIDRYPRKVTKKMGKNKLKKK 65
            |.|.||.||:|:||:|||:|.||:|||..||||.::|:.|.||||||.||||||..||| |:.|:
  Rat     1 MGKFMKPGKVVLVLAGRYSGYKAVIVKNIDDGTSDRPYSHVLVAGIDCYPRKVTAAMGK-KMAKR 64

  Fly    66 SKVKPFLKSLNYNHLMPTRYTAHDISFEK-LSPKDL-KDPVKRKTHRFQTRVKFESVYKEGKNKW 128
            ||:|.|:|..||:|||||||:. ||..:| :..||: :||..::..|.:.:||||..||.|||||
  Rat    65 SKIKSFVKVYNYSHLMPTRYSV-DIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKNKW 128

  Fly   129 FFQKLRF 135
            |||||||
  Rat   129 FFQKLRF 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL27NP_001262966.1 KOW 1..135 CDD:412330 79/135 (59%)
RGD1563835XP_038944828.1 KOW 1..135 CDD:412330 79/135 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352717
Domainoid 1 1.000 95 1.000 Domainoid score I7206
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4015
OMA 1 1.010 - - QHG53799
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001918
OrthoInspector 1 1.000 - - otm46386
orthoMCL 1 0.900 - - OOG6_101266
Panther 1 1.100 - - O PTHR10497
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.